PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn273911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 412aa    MW: 46997.5 Da    PI: 7.7187
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn273911genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK39.41.1e-12218260852
      RWP-RK   8 edlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ed+ +y + +  dAA++L  ++++ Kr CR+yGI+RWP R + ++
  Achn273911 218 EDILHYSKRSRCDAARNL--STSTFKRVCRKYGISRWPTRNVDKV 260
                 788999999999****98..6899*****************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.546194281IPR003035RWP-RK domain
PfamPF020421.1E-9218260IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDIIRLVRIH SLLVGDTSLV NSILAWTSLK KRDRVVGRAL SSPNLLYCSD VTQLSMAEYP  60
LAHFARECGL RGCFAISLRS NYTGNDVYLL EIFLPANNKD KDPLTSLNKI LETIKQEFKP  120
FRLASGEELG EELYVEVIEF QNGQKHHYVQ ILHVTGSLPS LEPLQNGGEI MQMDSSDHQS  180
NDAKQCEIDV NHPQELGIKK TSGREHKNTG VRIESPYEDI LHYSKRSRCD AARNLSTSTF  240
KRVCRKYGIS RWPTRNVDKV HHTKSVTPVS YIDCFPASLR PYIWHVKDVA LDGNYDYKIM  300
CGGQQTINEL THCLSWFGGC PGMDRWMAMP NRGLLIASCY NVVLYYLSNK QCLTFLPLSH  360
AVPPIESSWT LYHYQRAQGW ETAYNRRIQH FRELVNYNIA TTDAISLDEK E*
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.12e-27Nin-like family protein